Slope Direction, Elevation and Clutch Size Influences Breeding Success of White-Crested Kalij Pheasant (Lophura leucomelanos) in Margalla Hills National Park, Pakistan

نویسندگان

چکیده

برای دانلود باید عضویت طلایی داشته باشید

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.

The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGM...

متن کامل

Mitochondrial DNA diversification among the subspecies of the Silver and Kalij Pheasants, Lophura nycthemera and L. leucomelanos , Phasianidae

The taxonomic status of the pheasant superspecies Lophura leucomelanos and Lophura nycthemera has been unclear since 1948. Molecular techniques provided the opportunity to clarify the situation. Using sequences of mitochondrial DNA (800 nucleotides from the D-loop, plus 400 from the cyt b ) from 49 specimens belonging to 10 subspecies (plus two outgroups), we constructed a phylogeny of the subs...

متن کامل

Land use change detection in the limestone exploitation area of Margalla Hills National Park (MHNP), Islamabad, Pakistan using geo-spatial techniques

The aim of the study is to assess the limestone (LS) exploitation area and its negative impacts on natural resources using geo-spatial techniques. LS is an important constituent of cement manufacturing which is extensively used in the construction of infrastructure such as roads and buildings. The Margalla Hills National Park (MHNP) is situated around Islamabad and contains a large amount of LS...

متن کامل

Assessment of radiological hazard of NORM in Margalla Hills limestone, Pakistan.

Studies on naturally occurring radioactive material (NORM) in the limestone from the Margalla Hills have been carried out by measuring gamma activity and to access its radiological implications if any. For data acquisition, a High-Purity Germanium detector was employed. The activity concentrations of (226)Ra, (232)Th, and (40)K were found to be 14.32 ± 0.24, 2.05 ± 0.04, and 13.80 ± 0.20 Bq kg(...

متن کامل

Clutch size declines with elevation in tropical birds

Clutch size commonly decreases with increasing elevation among temperate-zone and subtropical songbird species. Tropical songbirds typically lay small clutches, thus the ability to evolve even smaller clutch sizes at higher elevations is unclear and untested. We conducted a comparative phylogenetic analysis using data gathered from the literature to test whether clutch size varied with elevatio...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: Pakistan Journal of Zoology

سال: 2023

ISSN: ['0030-9923']

DOI: https://doi.org/10.17582/journal.pjz/20220923120947